HIGHLIGHTS
- who: Deborah J. Watson from the Peptide Preparations and Electron Microscopy-Wild type Ab1- , peptide was synthesized and HPLC-purified by DrD. Teplow (Biopolymer Laboratory, Brigham and Women's Hospital). Ab1- , containing the E Q "Dutch" mutation (AbE Q) was made by Dr. D. Chin (University of Missouri, Columbia) and aliquots were HPLC-purified by Dr. D. Walsh (Biopolymer Facility, Brigham and Women's Hospital). Human and rat amylin peptides were purchased from Peninsula Laboratories (Belmont, CA) or Bachem (Torrance, CA). The amino acid sequence of wild type human Ab1- , is DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (see, e_g Ref., ) have published . . .

If you want to have access to all the content you need to log in!
Thanks :)
If you don't have an account, you can create one here.